Lineage for d1qh4a1 (1qh4 A:2-102)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5055Fold a.83: Guanido kinases [48033] (1 superfamily)
  4. 5056Superfamily a.83.1: Guanido kinases [48034] (1 family) (S)
  5. 5057Family a.83.1.1: Guanido kinases [48035] (2 proteins)
  6. 5061Protein Creatine kinase, N-terminal domain [48036] (5 species)
  7. 5062Species Chicken (Gallus gallus), brain-type [TaxId:9031] [48038] (1 PDB entry)
  8. 5063Domain d1qh4a1: 1qh4 A:2-102 [18462]
    Other proteins in same PDB: d1qh4a2, d1qh4b2, d1qh4c2, d1qh4d2

Details for d1qh4a1

PDB Entry: 1qh4 (more details), 1.41 Å

PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution

SCOP Domain Sequences for d1qh4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh4a1 a.83.1.1 (A:2-102) Creatine kinase, N-terminal domain {Chicken (Gallus gallus), brain-type}
pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykp

SCOP Domain Coordinates for d1qh4a1:

Click to download the PDB-style file with coordinates for d1qh4a1.
(The format of our PDB-style files is described here.)

Timeline for d1qh4a1: