Lineage for d1crkd1 (1crk D:1-98)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719236Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2719264Protein Creatine kinase, N-domain [48036] (7 species)
  7. 2719270Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [48037] (1 PDB entry)
  8. 2719274Domain d1crkd1: 1crk D:1-98 [18461]
    Other proteins in same PDB: d1crka2, d1crkb2, d1crkc2, d1crkd2
    complexed with po4

Details for d1crkd1

PDB Entry: 1crk (more details), 3 Å

PDB Description: mitochondrial creatine kinase
PDB Compounds: (D:) creatine kinase

SCOPe Domain Sequences for d1crkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crkd1 a.83.1.1 (D:1-98) Creatine kinase, N-domain {Chicken (Gallus gallus), mitochondria [TaxId: 9031]}
tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
hpfiktvgmvagdeesyevfaeifdpvikarhngydpr

SCOPe Domain Coordinates for d1crkd1:

Click to download the PDB-style file with coordinates for d1crkd1.
(The format of our PDB-style files is described here.)

Timeline for d1crkd1: