SCOPe 2.01: Domain d3qqoe_: 3qqo E:

Lineage for d3qqoe_ (3qqo E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (5 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries)

8. Domain d3qqoe_: 3qqo E: [184583]
   automated match to d1jsma_
   complexed with nag; mutant

Details for d3qqoe_

PDB Entry: 3qqo, 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d3qqoe_:

Sequence; same for both SEQRES and ATOM records:

>d3qqoe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
gecpkyvkseklvlatglrnvp

Timeline for d3qqoe_:

• d3qqoe_ is new in SCOPe 2.01-stable
  
• d3qqoe_ appears in SCOPe 2.02
  
• d3qqoe_ appears in the current release, SCOPe 2.08, called d3qqoe1