Lineage for d3qqoc_ (3qqo C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117059Protein Hemagglutinin [49824] (5 species)
    includes rudiment esterase domain
  7. 1117068Species Influenza A virus, different strains [TaxId:11320] [49825] (61 PDB entries)
  8. 1117177Domain d3qqoc_: 3qqo C: [184582]
    automated match to d1jsma_
    complexed with nag; mutant

Details for d3qqoc_

PDB Entry: 3qqo (more details), 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d3qqoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqoc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia
gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp
kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh
hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti
nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti
gecpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d3qqoc_:

Click to download the PDB-style file with coordinates for d3qqoc_.
(The format of our PDB-style files is described here.)

Timeline for d3qqoc_: