Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.2: UBX domain [54250] (6 proteins) Pfam PF00789 |
Protein automated matches [191298] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries) |
Domain d3qq8b_: 3qq8 B: [184576] Other proteins in same PDB: d3qq8a1, d3qq8a2 automated match to d1h8ca_ complexed with cl |
PDB Entry: 3qq8 (more details), 2 Å
SCOPe Domain Sequences for d3qq8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq8b_ d.15.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp nksllevklfpqetlfleak
Timeline for d3qq8b_: