Lineage for d3qoma_ (3qom A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1147016Species Lactobacillus plantarum [TaxId:1590] [189663] (1 PDB entry)
  8. 1147017Domain d3qoma_: 3qom A: [184549]
    automated match to d1bgaa_
    complexed with act, bgc, po4

Details for d3qoma_

PDB Entry: 3qom (more details), 1.5 Å

PDB Description: Crystal structure of 6-phospho-beta-glucosidase from Lactobacillus plantarum
PDB Compounds: (A:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d3qoma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qoma_ c.1.8.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
amtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagk
yypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfd
eclkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfn
einnqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqig
cmiamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditae
dlkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglrya
mnwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdlig
ytpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie

SCOPe Domain Coordinates for d3qoma_:

Click to download the PDB-style file with coordinates for d3qoma_.
(The format of our PDB-style files is described here.)

Timeline for d3qoma_: