SCOPe 2.08: Domain d3qo2a1: 3qo2 A:55-114

Lineage for d3qo2a1 (3qo2 A:55-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries)

8. Domain d3qo2a1: 3qo2 A:55-114 [184543]
   Other proteins in same PDB: d3qo2a2
   automated match to d2dnta1
   protein/DNA complex; complexed with edo

Details for d3qo2a1

PDB Entry: 3qo2, 2.49 Å

PDB Description: structural insights for mpp8 chromodomain interaction with histone h3 lysine 9

PDB Compounds: (A:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3qo2a1:

Sequence; same for both SEQRES and ATOM records:

>d3qo2a1 b.34.13.0 (A:55-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk

Timeline for d3qo2a1:

• d3qo2a1 first appeared in SCOPe 2.01, called d3qo2a_
  
• d3qo2a1 appears in SCOPe 2.07