Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (13 species) not a true protein |
Species Escherichia coli [TaxId:668369] [189787] (1 PDB entry) |
Domain d3qnbc_: 3qnb C: [184534] automated match to d1e4dc_ complexed with edo, so4 |
PDB Entry: 3qnb (more details), 1.95 Å
SCOPe Domain Sequences for d3qnbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qnbc_ e.3.1.1 (C:) automated matches {Escherichia coli [TaxId: 668369]} sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey lvhsktgwgmgvtpqvgwwvgwveketevyffafnmdidnesklplrksiptkimesegi ig
Timeline for d3qnbc_: