Lineage for d3qmqa1 (3qmq A:1-96)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950261Species Escherichia coli [TaxId:511145] [189909] (1 PDB entry)
  8. 2950262Domain d3qmqa1: 3qmq A:1-96 [184525]
    Other proteins in same PDB: d3qmqa2, d3qmqb2, d3qmqc2, d3qmqd2
    automated match to d2omoa1

Details for d3qmqa1

PDB Entry: 3qmq (more details), 1.8 Å

PDB Description: Crystal Structure of E. coli LsrG
PDB Compounds: (A:) Autoinducer-2 (AI-2) modifying protein LsrG

SCOPe Domain Sequences for d3qmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qmqa1 d.58.4.0 (A:1-96) automated matches {Escherichia coli [TaxId: 511145]}
mhvtlveinvhedkvdefievfrqnhlgsvqeegnlrfdvlqdpevnsrfyiyeaykded
avafhkttphyktcvakleslmtgprkkrlfnglmp

SCOPe Domain Coordinates for d3qmqa1:

Click to download the PDB-style file with coordinates for d3qmqa1.
(The format of our PDB-style files is described here.)

Timeline for d3qmqa1: