Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (2 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189656] (1 PDB entry) |
Domain d3qmng_: 3qmn G: [184506] automated match to d1f7la_ complexed with a3p, act, ca, cl, coa, mpd, mrd |
PDB Entry: 3qmn (more details), 1.85 Å
SCOPe Domain Sequences for d3qmng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qmng_ d.150.1.0 (G:) automated matches {Vibrio cholerae [TaxId: 243277]} amivglgtdiaeiervekalarsgenfarriltdseleqfhaskqqgrflakrfaakeaa skalgtgiaqgvtfhdftishdklgkpllilsgqaaelasqlqvenihlsisderhyama tviler
Timeline for d3qmng_: