Lineage for d3qmnb_ (3qmn B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044392Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1044393Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1044422Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1044423Protein automated matches [191061] (2 species)
    not a true protein
  7. 1044428Species Vibrio cholerae [TaxId:243277] [189656] (1 PDB entry)
  8. 1044430Domain d3qmnb_: 3qmn B: [184501]
    automated match to d1f7la_
    complexed with a3p, act, ca, cl, coa, mpd, mrd

Details for d3qmnb_

PDB Entry: 3qmn (more details), 1.85 Å

PDB Description: Crystal Structure of 4'-Phosphopantetheinyl Transferase AcpS from Vibrio cholerae O1 biovar eltor
PDB Compounds: (B:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3qmnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qmnb_ d.150.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
amivglgtdiaeiervekalarsgenfarriltdseleqfhaskqqgrflakrfaakeaa
skalgtgiaqgvtfhdftishdklgkpllilsgqaaelasqlqvenihlsisderhyama
tviler

SCOPe Domain Coordinates for d3qmnb_:

Click to download the PDB-style file with coordinates for d3qmnb_.
(The format of our PDB-style files is described here.)

Timeline for d3qmnb_: