Lineage for d1baq__ (1baq -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154545Fold a.79: Antitermination factor NusB [48012] (1 superfamily)
  4. 154546Superfamily a.79.1: Antitermination factor NusB [48013] (1 family) (S)
  5. 154547Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)
  6. 154548Protein Antitermination factor NusB [48015] (2 species)
  7. 154549Species Escherichia coli [TaxId:562] [48017] (2 PDB entries)
  8. 154551Domain d1baq__: 1baq - [18448]

Details for d1baq__

PDB Entry: 1baq (more details)

PDB Description: antitermination factor nusb from escherichia coli, nmr, 18 structures

SCOP Domain Sequences for d1baq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1baq__ a.79.1.1 (-) Antitermination factor NusB {Escherichia coli}
mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta
yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh
kfvngvldkaapvirpnkk

SCOP Domain Coordinates for d1baq__:

Click to download the PDB-style file with coordinates for d1baq__.
(The format of our PDB-style files is described here.)

Timeline for d1baq__: