Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium marinum [TaxId:216594] [189638] (4 PDB entries) |
Domain d3qk8a_: 3qk8 A: [184458] automated match to d1wz8a1 complexed with cl, edo, unl |
PDB Entry: 3qk8 (more details), 1.6 Å
SCOPe Domain Sequences for d3qk8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qk8a_ c.14.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]} tyqdfpslrfepgehgvlnlvldspglnsvgpqmhrdladvwpvidrdpdvrvvlvrgeg kafssggsfelidetigdyegririmreardlvlnlvnldkpvvsairgpavgaglvval ladisvasatakiidghtklgvaagdhaaicwpllvgmakakyylltcetlsgeeaerig lvstcvdddevlptatrlaenlaqgaqnairwtkrslnhwyrmfgptfetslgleflgft gpdvqeglaahrqkrparf
Timeline for d3qk8a_: