Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (4 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [189878] (9 PDB entries) |
Domain d3qjva_: 3qjv A: [184455] Other proteins in same PDB: d3qjvc_ automated match to d1ehka_ complexed with cmo, cu1, cua, has, hem |
PDB Entry: 3qjv (more details), 2.8 Å
SCOPe Domain Sequences for d3qjva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjva_ f.24.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} vyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqglt lhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneat vlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfw lmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiyti lpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpsl mtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasft ldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwfl gmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfs vllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlf ghlnpvpgwrlw
Timeline for d3qjva_: