Lineage for d3qjua_ (3qju A:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457625Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1457626Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1457627Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1457645Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 1457646Species Thermus thermophilus [TaxId:274] [81437] (19 PDB entries)
  8. 1457664Domain d3qjua_: 3qju A: [184454]
    Other proteins in same PDB: d3qjub1, d3qjub2, d3qjuc_
    automated match to d1ehka_
    complexed with cmo, cu1, cua, has, hem

Details for d3qjua_

PDB Entry: 3qju (more details), 2.9 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3qjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjua_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
vyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqglt
lhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneat
vlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfw
lmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiyti
lpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpsl
mtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasft
ldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwfl
gmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfs
vllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlf
ghlnpvpgwrlw

SCOPe Domain Coordinates for d3qjua_:

Click to download the PDB-style file with coordinates for d3qjua_.
(The format of our PDB-style files is described here.)

Timeline for d3qjua_: