SCOPe 2.02: Domain d3qjsa_: 3qjs A:

Lineage for d3qjsa_ (3qjs A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (4 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [189878] (9 PDB entries)

8. Domain d3qjsa_: 3qjs A: [184452]
   Other proteins in same PDB: d3qjsc_
   automated match to d1ehka_
   complexed with cmo, cu1, cua, has, hem

Details for d3qjsa_

PDB Entry: 3qjs, 2.8 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3qjsa_:

Sequence; same for both SEQRES and ATOM records:

>d3qjsa_ f.24.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
lvqlfghlnpvpgwrlw

Timeline for d3qjsa_:

• d3qjsa_ first appeared in SCOPe 2.01
  
• d3qjsa_ appears in SCOPe 2.03
  
• d3qjsa_ appears in the current release, SCOPe 2.07