![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein automated matches [190134] (4 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [189878] (5 PDB entries) |
![]() | Domain d3qjqa_: 3qjq A: [184451] automated match to d1ehka_ complexed with cmo, cu1, cua, has, hem |
PDB Entry: 3qjq (more details), 2.9 Å
SCOPe Domain Sequences for d3qjqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjqa_ f.24.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} vyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqglt lhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneat vlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfw lmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiyti lpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpsl mtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasft ldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwfl gmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfs vllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlf ghlnpvpgwrlw
Timeline for d3qjqa_: