SCOPe 2.01: Domain d3qhxa_: 3qhx A:

Lineage for d3qhxa_ (3qhx A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (25 species)
   not a true protein

7. Species Mycobacterium ulcerans [TaxId:362242] [189655] (2 PDB entries)

8. Domain d3qhxa_: 3qhx A: [184390]
   automated match to d1n8pa_
   complexed with epe, gol, na, so4

Details for d3qhxa_

PDB Entry: 3qhx, 1.65 Å

PDB Description: crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes

PDB Compounds: (A:) Cystathionine gamma-synthase MetB (Cgs)

SCOPe Domain Sequences for d3qhxa_:

Sequence; same for both SEQRES and ATOM records:

>d3qhxa_ c.67.1.0 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
aglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaal
aavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveytp
valadldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspal
qqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdaylt
mrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmvs
vrmragrtaaeqlcaktnifilaeslgsvesliehpsamthastagsqlevpddlvrlsv
giedvadllddlkqalg

Timeline for d3qhxa_:

• d3qhxa_ is new in SCOPe 2.01-stable
  
• d3qhxa_ appears in SCOPe 2.02
  
• d3qhxa_ appears in the current release, SCOPe 2.08