Lineage for d3qame_ (3qam E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220199Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 1220244Species Mouse (Mus musculus) [TaxId:10090] [56119] (24 PDB entries)
  8. 1220249Domain d3qame_: 3qam E: [184309]
    automated match to d1cmke_
    complexed with atp, mg; mutant

Details for d3qame_

PDB Entry: 3qam (more details), 1.92 Å

PDB Description: Crystal Structure of Glu208Ala mutant of catalytic subunit of cAMP-dependent protein kinase
PDB Compounds: (E:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3qame_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qame_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapaiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d3qame_:

Click to download the PDB-style file with coordinates for d3qame_.
(The format of our PDB-style files is described here.)

Timeline for d3qame_: