Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries) |
Domain d3q90b1: 3q90 B:1-139 [184279] Other proteins in same PDB: d3q90b2 automated match to d1zo2a1 |
PDB Entry: 3q90 (more details), 1.7 Å
SCOPe Domain Sequences for d3q90b1:
Sequence, based on SEQRES records: (download)
>d3q90b1 d.17.4.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv ankfyvhndifryqdevfg
>d3q90b1 d.17.4.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldpadavygqkeihrk vmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapefyvhndi fryqdevfg
Timeline for d3q90b1: