Lineage for d3q7qb_ (3q7q B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164515Protein automated matches [190047] (16 species)
    not a true protein
  7. 1164553Species Human (Homo sapiens) [TaxId:9606] [186768] (72 PDB entries)
  8. 1164642Domain d3q7qb_: 3q7q B: [184263]
    automated match to d2gjsa1
    complexed with ca, gnp, mg

Details for d3q7qb_

PDB Entry: 3q7q (more details), 2.3 Å

PDB Description: Crystal Structure of Rad G-domain Q148A-GTP Analog Complex
PDB Compounds: (B:) GTP-binding protein RAD

SCOPe Domain Sequences for d3q7qb_:

Sequence, based on SEQRES records: (download)

>d3q7qb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqd
ggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvr
srevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrr

Sequence, based on observed residues (ATOM records): (download)

>d3q7qb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svykvlllgapgvgksalarifggvghtydrsivvdgeeaslmvydiwemgdayvivysv
tdkgsfekaselrvqlrradvpiilvgnksdlvrsrevsvdegracavvfdckfietsaa
lhhnvqalfegvvrqirlrr

SCOPe Domain Coordinates for d3q7qb_:

Click to download the PDB-style file with coordinates for d3q7qb_.
(The format of our PDB-style files is described here.)

Timeline for d3q7qb_: