SCOPe 2.07: Domain d3q3mg_: 3q3m G:

Lineage for d3q3mg_ (3q3m G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.0: automated matches [191572] (1 protein)
   not a true family

6. Protein automated matches [190991] (1 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)

8. Domain d3q3mg_: 3q3m G: [184190]
   Other proteins in same PDB: d3q3ma_, d3q3md_, d3q3me_, d3q3mh_
   automated match to d1t0rc_
   complexed with fe, z82

Details for d3q3mg_

PDB Entry: 3q3m, 1.75 Å

PDB Description: toluene 4 monooxygenase hd complex with inhibitor 4-bromobenzoate

PDB Compounds: (G:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3q3mg_:

Sequence; same for both SEQRES and ATOM records:

>d3q3mg_ d.15.12.0 (G:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

Timeline for d3q3mg_:

• d3q3mg_ first appeared in SCOPe 2.01
  
• d3q3mg_ appears in SCOPe 2.06
  
• d3q3mg_ appears in the current release, SCOPe 2.08