Lineage for d3q3gl_ (3q3g L:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144675Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 2144688Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2144689Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries)
  8. 2144705Domain d3q3gl_: 3q3g L: [184183]
    Other proteins in same PDB: d3q3ga1, d3q3ga2, d3q3gc1, d3q3gc2, d3q3gf1, d3q3gf2, d3q3gj1, d3q3gj2
    automated match to d1bho1_
    complexed with ca, cl, edo, gol, na, peg

Details for d3q3gl_

PDB Entry: 3q3g (more details), 2.7 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (L:) Integrin alpha-M

SCOPe Domain Sequences for d3q3gl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3gl_ c.62.1.1 (L:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrekifaie

SCOPe Domain Coordinates for d3q3gl_:

Click to download the PDB-style file with coordinates for d3q3gl_.
(The format of our PDB-style files is described here.)

Timeline for d3q3gl_: