Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53309] (11 PDB entries) |
Domain d3q3gi_: 3q3g I: [184182] Other proteins in same PDB: d3q3ga1, d3q3ga2, d3q3gc1, d3q3gc2, d3q3gf1, d3q3gf2, d3q3gj1, d3q3gj2 automated match to d1bho1_ complexed with ca, cl, edo, gol, na, peg |
PDB Entry: 3q3g (more details), 2.7 Å
SCOPe Domain Sequences for d3q3gi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3gi_ c.62.1.1 (I:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq lrekifaie
Timeline for d3q3gi_: