Lineage for d3q3ge_ (3q3g E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892209Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2892210Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries)
  8. 2892217Domain d3q3ge_: 3q3g E: [184180]
    Other proteins in same PDB: d3q3ga1, d3q3ga2, d3q3gb1, d3q3gb2, d3q3gc1, d3q3gc2, d3q3gd1, d3q3gd2, d3q3gf1, d3q3gf2, d3q3gh1, d3q3gh2, d3q3gj1, d3q3gj2, d3q3gk1, d3q3gk2
    automated match to d1bho1_
    complexed with ca, cl, edo, gol, na, peg

Details for d3q3ge_

PDB Entry: 3q3g (more details), 2.7 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (E:) Integrin alpha-M

SCOPe Domain Sequences for d3q3ge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3ge_ c.62.1.1 (E:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrekifaie

SCOPe Domain Coordinates for d3q3ge_:

Click to download the PDB-style file with coordinates for d3q3ge_.
(The format of our PDB-style files is described here.)

Timeline for d3q3ge_: