Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family automatically mapped to Pfam PF02569 |
Protein automated matches [191096] (2 species) not a true protein |
Species Yersinia pestis [TaxId:632] [189627] (2 PDB entries) |
Domain d3q12b1: 3q12 B:1-282 [184140] Other proteins in same PDB: d3q12a2, d3q12b2, d3q12c2, d3q12d2 automated match to d1ihoa_ complexed with cl, paf |
PDB Entry: 3q12 (more details), 1.58 Å
SCOPe Domain Sequences for d3q12b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q12b1 c.26.1.4 (B:1-282) automated matches {Yersinia pestis [TaxId: 632]} mliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnpl qferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstileg asrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvra kdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgftp delfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdl
Timeline for d3q12b1: