SCOPe 2.07: Domain d3q12a1: 3q12 A:1-284

Lineage for d3q12a1 (3q12 A:1-284)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
   automatically mapped to Pfam PF02569

6. Protein automated matches [191096] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [189627] (2 PDB entries)

8. Domain d3q12a1: 3q12 A:1-284 [184139]
   Other proteins in same PDB: d3q12a2, d3q12b2, d3q12c2, d3q12d2
   automated match to d1ihoa_
   complexed with cl, paf

Details for d3q12a1

PDB Entry: 3q12, 1.58 Å

PDB Description: pantoate-beta-alanine ligase from yersinia pestis in complex with pantoate.

PDB Compounds: (A:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d3q12a1:

Sequence; same for both SEQRES and ATOM records:

>d3q12a1 c.26.1.4 (A:1-284) automated matches {Yersinia pestis [TaxId: 632]}
mliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnpl
qferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstileg
asrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvra
kdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgftp
delfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh

Timeline for d3q12a1:

• d3q12a1 first appeared in SCOPe 2.01, called d3q12a_
  
• d3q12a1 appears in SCOPe 2.06
  
• d3q12a1 appears in the current release, SCOPe 2.08