Lineage for d3q0jd_ (3q0j D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585523Species Mycobacterium tuberculosis [TaxId:83332] [187022] (7 PDB entries)
  8. 1585530Domain d3q0jd_: 3q0j D: [184117]
    automated match to d1duba_
    complexed with caa

Details for d3q0jd_

PDB Entry: 3q0j (more details), 2.4 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Crotonase in complex with the Inhibitor AcetoacetylCoA
PDB Compounds: (D:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3q0jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0jd_ c.14.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqfth

SCOPe Domain Coordinates for d3q0jd_:

Click to download the PDB-style file with coordinates for d3q0jd_.
(The format of our PDB-style files is described here.)

Timeline for d3q0jd_: