Lineage for d3q0gb_ (3q0g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854044Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries)
  8. 2854080Domain d3q0gb_: 3q0g B: [184109]
    automated match to d1duba_
    complexed with bco, coa, gol, mg

Details for d3q0gb_

PDB Entry: 3q0g (more details), 2.38 Å

PDB Description: crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
PDB Compounds: (B:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3q0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0gb_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqf

SCOPe Domain Coordinates for d3q0gb_:

Click to download the PDB-style file with coordinates for d3q0gb_.
(The format of our PDB-style files is described here.)

Timeline for d3q0gb_: