SCOPe 2.08: Domain d3pxwc_: 3pxw C:

Lineage for d3pxwc_ (3pxw C:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (3 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)

8. Domain d3pxwc_: 3pxw C: [184070]
   automated match to d1mg2b_
   complexed with act, ca, edo, hec, na, no, pg6, pge

Details for d3pxwc_

PDB Entry: 3pxw, 2.11 Å

PDB Description: crystal structure of ferrous no adduct of maug in complex with pre- methylamine dehydrogenase

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3pxwc_:

Sequence; same for both SEQRES and ATOM records:

>d3pxwc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d3pxwc_:

• d3pxwc_ first appeared in SCOPe 2.01
  
• d3pxwc_ appears in SCOPe 2.07