Lineage for d3pxte_ (3pxt E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034510Protein automated matches [190303] (3 species)
    not a true protein
  7. 3034529Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)
  8. 3034547Domain d3pxte_: 3pxt E: [184068]
    Other proteins in same PDB: d3pxtd_, d3pxtf_
    automated match to d1mg2b_
    complexed with act, ca, cmo, hec, na, pg6

Details for d3pxte_

PDB Entry: 3pxt (more details), 2.16 Å

PDB Description: crystal structure of ferrous co adduct of maug in complex with pre- methylamine dehydrogenase
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3pxte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxte_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3pxte_:

Click to download the PDB-style file with coordinates for d3pxte_.
(The format of our PDB-style files is described here.)

Timeline for d3pxte_: