Lineage for d3pxsc_ (3pxs C:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585672Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2585673Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2585674Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2585675Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2585676Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2585705Domain d3pxsc_: 3pxs C: [184065]
    Other proteins in same PDB: d3pxsd_, d3pxsf_
    automated match to d1mg2b_
    complexed with act, ca, hec, na, pg4, pg6

Details for d3pxsc_

PDB Entry: 3pxs (more details), 2.22 Å

PDB Description: crystal structure of diferrous maug in complex with pre-methylamine dehydrogenase:
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3pxsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxsc_ g.21.1.1 (C:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3pxsc_:

Click to download the PDB-style file with coordinates for d3pxsc_.
(The format of our PDB-style files is described here.)

Timeline for d3pxsc_: