Lineage for d3pwqe1 (3pwq E:2-248)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703653Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)
  8. 2703664Domain d3pwqe1: 3pwq E:2-248 [184045]
    Other proteins in same PDB: d3pwqa2, d3pwqb2, d3pwqe2, d3pwqg2, d3pwqi2, d3pwqj2, d3pwqr2
    automated match to d1otka_

Details for d3pwqe1

PDB Entry: 3pwq (more details), 2.65 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex
PDB Compounds: (E:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pwqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwqe1 a.25.1.2 (E:2-248) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr
vlpgqqw

SCOPe Domain Coordinates for d3pwqe1:

Click to download the PDB-style file with coordinates for d3pwqe1.
(The format of our PDB-style files is described here.)

Timeline for d3pwqe1: