SCOPe 2.03: Domain d3pwda_: 3pwd A:

Lineage for d3pwda_ (3pwd A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Maize (Zea mays) [TaxId:4577] [56143] (31 PDB entries)

8. Domain d3pwda_: 3pwd A: [184033]
   automated match to d1f0qa_
   complexed with cz0

Details for d3pwda_

PDB Entry: 3pwd, 2.2 Å

PDB Description: crystal structure of maize ck2 in complex with nbc (z1)

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3pwda_:

Sequence; same for both SEQRES and ATOM records:

>d3pwda_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

Timeline for d3pwda_:

• d3pwda_ first appeared in SCOPe 2.01
  
• d3pwda_ appears in SCOPe 2.02
  
• d3pwda_ appears in SCOPe 2.04
  
• d3pwda_ appears in the current release, SCOPe 2.08