SCOPe 2.08: Domain d3pw8a_: 3pw8 A:

Lineage for d3pw8a_ (3pw8 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)

8. Domain d3pw8a_: 3pw8 A: [184027]
   automated match to d1otka_
   complexed with aco

Details for d3pw8a_

PDB Entry: 3pw8, 2.97 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with acetyl-CoA

PDB Compounds: (A:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pw8a_:

Sequence; same for both SEQRES and ATOM records:

>d3pw8a_ a.25.1.2 (A:) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr
vlpgqqw

Timeline for d3pw8a_:

• d3pw8a_ first appeared in SCOPe 2.01
  
• d3pw8a_ appears in SCOPe 2.07