Class b: All beta proteins [48724] (176 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (20 PDB entries) |
Domain d3pvwb_: 3pvw B: [184021] Other proteins in same PDB: d3pvwa1, d3pvwa2, d3pvwa3, d3pvwg_ automated match to d1b9xa_ complexed with qrx |
PDB Entry: 3pvw (more details), 2.49 Å
SCOPe Domain Sequences for d3pvwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvwb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam hwgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk adragvlaghdnrvsclgvtddgmavatgswdsflkiw
Timeline for d3pvwb_:
View in 3D Domains from other chains: (mouse over for more information) d3pvwa1, d3pvwa2, d3pvwa3, d3pvwg_ |