Lineage for d3puvg_ (3puv G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029031Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 3029032Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 3029033Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 3029070Protein automated matches [191243] (1 species)
    not a true protein
  7. 3029071Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries)
  8. 3029075Domain d3puvg_: 3puv G: [183983]
    Other proteins in same PDB: d3puva1, d3puva2, d3puva3, d3puvb1, d3puvb2, d3puve1, d3puve2, d3puvf1, d3puvf2
    automated match to d2r6gg1
    complexed with adp, mg, pgv, umq, vo4

Details for d3puvg_

PDB Entry: 3puv (more details), 2.4 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
PDB Compounds: (G:) Maltose transport system permease protein malG

SCOPe Domain Sequences for d3puvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puvg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklalgfsve
qadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllkgmlif
qmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfetidssl
eeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsytlavg
mqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg

SCOPe Domain Coordinates for d3puvg_:

Click to download the PDB-style file with coordinates for d3puvg_.
(The format of our PDB-style files is described here.)

Timeline for d3puvg_: