Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.58: MetI-like [161097] (1 superfamily) core: 5 transmembrane helices; flattened bundle |
Superfamily f.58.1: MetI-like [161098] (1 family) |
Family f.58.1.1: MetI-like [161099] (6 proteins) Pfam PF00528; Binding-protein-dependent transport system inner membrane component |
Protein automated matches [191243] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries) |
Domain d3puvg_: 3puv G: [183983] Other proteins in same PDB: d3puva1, d3puva2, d3puva3, d3puvb1, d3puvb2, d3puve1, d3puve2, d3puvf1, d3puvf2 automated match to d2r6gg1 complexed with adp, mg, pgv, umq, vo4 |
PDB Entry: 3puv (more details), 2.4 Å
SCOPe Domain Sequences for d3puvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3puvg_ f.58.1.1 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} qkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklalgfsve qadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllkgmlif qmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfetidssl eeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsytlavg mqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg
Timeline for d3puvg_: