Lineage for d1hnxg_ (1hnx G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644314Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 644315Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 644316Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 644317Protein Ribosomal protein S7 [47975] (3 species)
  7. 644322Species Thermus thermophilus [TaxId:274] [47977] (38 PDB entries)
  8. 644338Domain d1hnxg_: 1hnx G: [18398]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxg_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d1hnxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1hnxg_:

Click to download the PDB-style file with coordinates for d1hnxg_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxg_: