SCOP 1.65: Domain d1hnwg_: 1hnw G:

Lineage for d1hnwg_ (1hnw G:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries)

8. Domain d1hnwg_: 1hnw G: [18397]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwg_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwg_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1hnwg_:

• d1hnwg_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwg_ appears in SCOP 1.63
  
• d1hnwg_ appears in SCOP 1.67
  
• d1hnwg_ appears in the current release, SCOPe 2.08