Lineage for d1hnzg_ (1hnz G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092301Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1092302Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1092303Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1092304Protein Ribosomal protein S7 [47975] (4 species)
  7. 1092334Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1092350Domain d1hnzg_: 1hnz G: [18396]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzg_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1hnzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1hnzg_:

Click to download the PDB-style file with coordinates for d1hnzg_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzg_: