Lineage for d1hr0g_ (1hr0 G:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49283Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
  4. 49284Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 49285Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 49286Protein Ribosomal protein S7 [47975] (3 species)
  7. 49291Species Thermus thermophilus [TaxId:274] [47977] (11 PDB entries)
  8. 49297Domain d1hr0g_: 1hr0 G: [18395]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0g_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1hr0g_:

Click to download the PDB-style file with coordinates for d1hr0g_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0g_: