Lineage for d3prve_ (3prv E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951850Species Trypanosoma cruzi [TaxId:5693] [189957] (1 PDB entry)
  8. 2951855Domain d3prve_: 3prv E: [183944]
    automated match to d1be4a_

Details for d3prve_

PDB Entry: 3prv (more details), 2.69 Å

PDB Description: nucleoside diphosphate kinase b from trypanosoma cruzi
PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3prve_:

Sequence, based on SEQRES records: (download)

>d3prve_ d.58.6.0 (E:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
tsertfiavkpdgvqrclvgeiiqrfekkgyklvalkmlqpsaeqaqqhyidlaskpfyk
dlvayfssgpivgmvwegkgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsds
vdsakreiafwfkpeelvnwtshsvkqvye

Sequence, based on observed residues (ATOM records): (download)

>d3prve_ d.58.6.0 (E:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
tsertfiavkpdgvqrclvgeiiqrfekkgyklvalkmlqpsaeqaqqykdlvayfssgp
ivgmvwegkgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsdsvdsakreiaf
wfkpeelvnwtshsvkqvye

SCOPe Domain Coordinates for d3prve_:

Click to download the PDB-style file with coordinates for d3prve_.
(The format of our PDB-style files is described here.)

Timeline for d3prve_: