Lineage for d1fjgg_ (1fjg G:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99250Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
  4. 99251Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 99252Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 99253Protein Ribosomal protein S7 [47975] (3 species)
  7. 99258Species Thermus thermophilus [TaxId:274] [47977] (11 PDB entries)
  8. 99260Domain d1fjgg_: 1fjg G: [18394]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgg_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1fjgg_:

Click to download the PDB-style file with coordinates for d1fjgg_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgg_: