Lineage for d1rss__ (1rss -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540533Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 540534Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 540535Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 540536Protein Ribosomal protein S7 [47975] (3 species)
  7. 540541Species Thermus thermophilus [TaxId:274] [47977] (19 PDB entries)
  8. 540542Domain d1rss__: 1rss - [18392]
    mutant

Details for d1rss__

PDB Entry: 1rss (more details), 1.9 Å

PDB Description: ribosomal protein s7 from thermus thermophilus

SCOP Domain Sequences for d1rss__:

Sequence, based on SEQRES records: (download)

>d1rss__ a.75.1.1 (-) Ribosomal protein S7 {Thermus thermophilus}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermaeanrayahyrw

Sequence, based on observed residues (ATOM records): (download)

>d1rss__ a.75.1.1 (-) Ribosomal protein S7 {Thermus thermophilus}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermaeahyrw

SCOP Domain Coordinates for d1rss__:

Click to download the PDB-style file with coordinates for d1rss__.
(The format of our PDB-style files is described here.)

Timeline for d1rss__: