SCOPe 2.03: Domain d3pmja_: 3pmj A:

Lineage for d3pmja_ (3pmj A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d3pmja_: 3pmj A: [183847]
   automated match to d1v2kt_
   complexed with ca, cl, gol, pmj, so4

Details for d3pmja_

PDB Entry: 3pmj, 1.45 Å

PDB Description: Bovine trypsin variant X(tripleIle227) in complex with small molecule inhibitor

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3pmja_:

Sequence; same for both SEQRES and ATOM records:

>d3pmja_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgsgcaqknkpgiytkvcnyvswikqtiasn

Timeline for d3pmja_:

• d3pmja_ first appeared in SCOPe 2.01
  
• d3pmja_ appears in SCOPe 2.02
  
• d3pmja_ appears in SCOPe 2.04
  
• d3pmja_ appears in the current release, SCOPe 2.08