Lineage for d3pkpb_ (3pkp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898466Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2898597Protein automated matches [191218] (6 species)
    not a true protein
  7. 2898695Species Salmonella typhimurium [TaxId:90371] [189600] (2 PDB entries)
  8. 2898701Domain d3pkpb_: 3pkp B: [183810]
    automated match to d1iima_
    complexed with dtp, mg

Details for d3pkpb_

PDB Entry: 3pkp (more details), 2.6 Å

PDB Description: q83s variant of s. enterica rmla with datp
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d3pkpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pkpb_ c.68.1.6 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ktrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqdt
prfqqllgdgsqwglnlqykvspspdglaqafiigeefighddcalvlgdnifyghdlpk
lmeaavnkesgatvfayhvndperygvvefdqkgtavsleekplqpksnyavtglyfydn
svvemaknlkpsargeleitdinriymeqgrlsvammgrgyawldtgthqslieasnfia
tieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmvk

SCOPe Domain Coordinates for d3pkpb_:

Click to download the PDB-style file with coordinates for d3pkpb_.
(The format of our PDB-style files is described here.)

Timeline for d3pkpb_: