Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
Protein automated matches [191218] (6 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189600] (2 PDB entries) |
Domain d3pkpb_: 3pkp B: [183810] automated match to d1iima_ complexed with dtp, mg |
PDB Entry: 3pkp (more details), 2.6 Å
SCOPe Domain Sequences for d3pkpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pkpb_ c.68.1.6 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} ktrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqdt prfqqllgdgsqwglnlqykvspspdglaqafiigeefighddcalvlgdnifyghdlpk lmeaavnkesgatvfayhvndperygvvefdqkgtavsleekplqpksnyavtglyfydn svvemaknlkpsargeleitdinriymeqgrlsvammgrgyawldtgthqslieasnfia tieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmvk
Timeline for d3pkpb_: