SCOPe 2.04: Domain d3piaa_: 3pia A:

Lineage for d3piaa_ (3pia A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)

8. Domain d3piaa_: 3pia A: [183767]
   Other proteins in same PDB: d3piab_, d3piad_
   automated match to d1fsxa_
   complexed with cmo, hem

Details for d3piaa_

PDB Entry: 3pia, 2.1 Å

PDB Description: Site-specific Glycosylation of Hemoglobin Utilizing Oxime Ligation Chemistry as a Viable Alternative to PEGylation

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3piaa_:

Sequence; same for both SEQRES and ATOM records:

>d3piaa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

Timeline for d3piaa_:

• d3piaa_ first appeared in SCOPe 2.01
  
• d3piaa_ appears in SCOPe 2.03
  
• d3piaa_ appears in SCOPe 2.05
  
• d3piaa_ appears in the current release, SCOPe 2.08