Lineage for d3ph2b_ (3ph2 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257170Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1257525Protein automated matches [190113] (12 species)
    not a true protein
  7. 1257550Species Phormidium laminosum [TaxId:32059] [187369] (2 PDB entries)
  8. 1257551Domain d3ph2b_: 3ph2 B: [183731]
    automated match to d1c6sa_
    complexed with hem, imd

Details for d3ph2b_

PDB Entry: 3ph2 (more details), 1.4 Å

PDB Description: structure of the imidazole-adduct of the phormidium laminosum cytochrome c6 q51v variant
PDB Compounds: (B:) cytochrome c6

SCOPe Domain Sequences for d3ph2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ph2b_ a.3.1.1 (B:) automated matches {Phormidium laminosum [TaxId: 32059]}
adlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittvvtngkagmpa
fkgrltddqiaavaayvldqaekgw

SCOPe Domain Coordinates for d3ph2b_:

Click to download the PDB-style file with coordinates for d3ph2b_.
(The format of our PDB-style files is described here.)

Timeline for d3ph2b_: