SCOPe 2.08: Domain d3pfpa1: 3pfp A:1-462

Lineage for d3pfpa1 (3pfp A:1-462)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
   Pfam PF01474

6. Protein automated matches [191084] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189668] (4 PDB entries)

8. Domain d3pfpa1: 3pfp A:1-462 [183697]
   Other proteins in same PDB: d3pfpa2, d3pfpb2
   automated match to d2b7oa1
   complexed with 035, 036, cl, mn, so4

Details for d3pfpa1

PDB Entry: 3pfp, 2.35 Å

PDB Description: Structure of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase from Mycobacterium tuberculosis in complex with an active site inhibitor

PDB Compounds: (A:) Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG

SCOPe Domain Sequences for d3pfpa1:

Sequence; same for both SEQRES and ATOM records:

>d3pfpa1 c.1.10.8 (A:1-462) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Timeline for d3pfpa1:

• d3pfpa1 first appeared in SCOPe 2.01, called d3pfpa_
  
• d3pfpa1 appears in SCOPe 2.07