SCOPe 2.01: Domain d3pela_: 3pel A:

Lineage for d3pela_ (3pel A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Canis lupus [TaxId:9615] [189534] (1 PDB entry)

8. Domain d3pela_: 3pel A: [183685]
   Other proteins in same PDB: d3pelb_
   automated match to d1fhja_
   complexed with hem

Details for d3pela_

PDB Entry: 3pel, 1.9 Å

PDB Description: Structure of Greyhound Hemoglobin: Origin of High Oxygen Affinity

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3pela_:

Sequence; same for both SEQRES and ATOM records:

>d3pela_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Canis lupus [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr

Timeline for d3pela_:

• d3pela_ is new in SCOPe 2.01-stable
  
• d3pela_ appears in SCOPe 2.02
  
• d3pela_ appears in the current release, SCOPe 2.08